PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G45580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 264aa    MW: 29472.2 Da    PI: 8.9299
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G45580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.5e-33761155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  AT5G45580.1  7 KPRLRWTADLHDRFVDAVAKLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRL 61
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.285464IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-31463IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24762IPR006447Myb domain, plants
SuperFamilySSF466891.97E-16764IPR009057Homeodomain-like
PfamPF002491.4E-9960IPR001005SANT/Myb domain
PfamPF143791.3E-19112157IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MMTRDPKPRL RWTADLHDRF VDAVAKLGGA DKATPKSVLK LMGLKGLTLY HLKSHLQKYR  60
LGQQQGKKQN RTEQNKENAG SSYVHFDNCS QGGISNDSRF DNHQRQSGNV PFAEAMRHQV  120
DAQQRFQEQL EVQKKLQMRM EAQGKYLLTL LEKAQKSLPC GNAGETDKGQ FSDFNLALSG  180
LVGSDRKNEK AGLVTDISHL NGGDSSQEFR LCGEQEKIET GDACVKPESG FVHFDLNSKS  240
GYDLLNCGKY GIEVKPNVIG DRLQ
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO795301500.0
Expression AtlasAT5G45580-
AtGenExpressAT5G45580-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G45580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G45580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0120030.0BT012003.1 Arabidopsis thaliana At5g45580 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199371.20.0homeodomain-like superfamily protein
TrEMBLF4KEK20.0F4KEK2_ARATH; Homeodomain-like superfamily protein
STRINGAT5G45580.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]